GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

AKT1 (AKT serine/threonine kinase 1)

Gene

207

AKT serine/threonine kinase 1

AKT1

AKT, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA

14q32.33

This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain,

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434592	C>T	Pathogenic, likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant, non coding transcript variant
rs368667384	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, non coding transcript variant
rs397514644	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs397514645	T>G	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057518602	T>C	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1057519804	G>T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs1595251483	TC>CT	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

Show/Hide all(453)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003984	hsa-miR-199a-3p	Western blot	18456660
MIRT004363	hsa-miR-125b-5p	qRT-PCR, Western blot	18649363
MIRT004701	hsa-miR-185-5p	Flow, Immunoblot, Microarray, qRT-PCR	19688090
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005355	hsa-miR-149-3p	Luciferase reporter assay, qRT-PCR, Western blot	20623644
MIRT005740	hsa-miR-451a	qRT-PCR, Western blot	20816946
MIRT007171	hsa-miR-302a-3p	Luciferase reporter assay	23185040
MIRT007171	hsa-miR-302a-3p	Luciferase reporter assay	23185040
MIRT007172	hsa-miR-302b-3p	Luciferase reporter assay	23185040
MIRT007172	hsa-miR-302b-3p	Luciferase reporter assay	23185040
MIRT007173	hsa-miR-302c-3p	Luciferase reporter assay	23185040
MIRT007173	hsa-miR-302c-3p	Luciferase reporter assay	23185040
MIRT007174	hsa-miR-302d-3p	Luciferase reporter assay	23185040
MIRT007174	hsa-miR-302d-3p	Luciferase reporter assay	23185040
MIRT007179	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23104321
MIRT005355	hsa-miR-149-3p	Reporter assay;Western blot;qRT-PCR;Other	20623644
MIRT029530	hsa-miR-26b-5p	Microarray	19088304
MIRT041236	hsa-miR-193b-3p	CLASH	23622248
MIRT053334	hsa-miR-100-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23724047
MIRT054156	hsa-miR-19a-3p	qRT-PCR, Western blot	25400827
MIRT054875	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	25414595
MIRT437386	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT437912	hsa-miR-105-5p	Luciferase reporter assay, Western blot	25280563
MIRT054156	hsa-miR-19a-3p	qRT-PCR, Western blot	25914465
MIRT438059	hsa-miR-27a-5p	In situ hybridization, qRT-PCR	23963114
MIRT054156	hsa-miR-19a-3p	qRT-PCR, Western blot	25914465
MIRT438059	hsa-miR-27a-5p	In situ hybridization, qRT-PCR	23963114
MIRT543156	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT543155	hsa-miR-188-5p	PAR-CLIP	21572407
MIRT543154	hsa-miR-6866-3p	PAR-CLIP	21572407
MIRT543153	hsa-miR-7110-3p	PAR-CLIP	21572407
MIRT543151	hsa-miR-6817-3p	PAR-CLIP	21572407
MIRT543152	hsa-miR-518c-5p	PAR-CLIP	21572407
MIRT543150	hsa-miR-326	PAR-CLIP	21572407
MIRT543149	hsa-miR-330-5p	PAR-CLIP	21572407
MIRT543148	hsa-miR-6764-3p	PAR-CLIP	21572407
MIRT543147	hsa-miR-6824-3p	PAR-CLIP	21572407
MIRT543146	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT543145	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT543144	hsa-miR-378b	PAR-CLIP	21572407
MIRT543143	hsa-miR-378c	PAR-CLIP	21572407
MIRT543142	hsa-miR-378d	PAR-CLIP	21572407
MIRT543141	hsa-miR-378e	PAR-CLIP	21572407
MIRT543140	hsa-miR-378f	PAR-CLIP	21572407
MIRT543139	hsa-miR-378h	PAR-CLIP	21572407
MIRT543138	hsa-miR-378i	PAR-CLIP	21572407
MIRT543137	hsa-miR-422a	PAR-CLIP	21572407
MIRT543136	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT543135	hsa-miR-6873-3p	PAR-CLIP	21572407
MIRT543134	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT442870	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442869	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442868	hsa-miR-4757-3p	PAR-CLIP	22100165
MIRT442867	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442866	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442865	hsa-miR-496	PAR-CLIP	22100165
MIRT442864	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT442863	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	25187230
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	25187230
MIRT731198	hsa-miR-637	Immunohistochemistry, In situ hybridization, Western blot, Luciferase reporter assay	25597410
MIRT731198	hsa-miR-637	Immunohistochemistry, In situ hybridization, Western blot, Luciferase reporter assay	25597410
MIRT731805	hsa-miR-495-3p	Luciferase reporter assay, qRT-PCR, Western blot	27323412
MIRT731805	hsa-miR-495-3p	Luciferase reporter assay, qRT-PCR, Western blot	27323412
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT731064	hsa-miR-99a-5p	Luciferase reporter assay	27158364
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT277753	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT000425	hsa-miR-184	Luciferase reporter assay	27666871
MIRT736014	hsa-miR-126-3p	qRT-PCR, Western blot	26659078
MIRT732949	hsa-miR-4443	Microarray	33511213
MIRT735075	hsa-miR-6089	Luciferase reporter assay, Western blotting, qRT-PCR	33028811
MIRT736013	hsa-miR-23b-3p	Immunofluorescence, qRT-PCR, Flow cytometry	32865424
MIRT736014	hsa-miR-126-3p	qRT-PCR	32865424
MIRT736501	hsa-miR-148a-3p	qRT-PCR	32624692
MIRT737431	hsa-miR-429	Luciferase reporter assay, Western blotting, qRT-PCR	31814979
MIRT543156	hsa-miR-625-3p	PAR-CLIP	21572407
MIRT543155	hsa-miR-188-5p	PAR-CLIP	21572407
MIRT543154	hsa-miR-6866-3p	PAR-CLIP	21572407
MIRT543153	hsa-miR-7110-3p	PAR-CLIP	21572407
MIRT543151	hsa-miR-6817-3p	PAR-CLIP	21572407
MIRT543152	hsa-miR-518c-5p	PAR-CLIP	21572407
MIRT543150	hsa-miR-326	PAR-CLIP	21572407
MIRT543149	hsa-miR-330-5p	PAR-CLIP	21572407
MIRT543148	hsa-miR-6764-3p	PAR-CLIP	21572407
MIRT543147	hsa-miR-6824-3p	PAR-CLIP	21572407
MIRT543146	hsa-miR-4638-3p	PAR-CLIP	21572407
MIRT543145	hsa-miR-378a-3p	PAR-CLIP	21572407
MIRT543144	hsa-miR-378b	PAR-CLIP	21572407
MIRT543143	hsa-miR-378c	PAR-CLIP	21572407
MIRT543142	hsa-miR-378d	PAR-CLIP	21572407
MIRT543141	hsa-miR-378e	PAR-CLIP	21572407
MIRT543140	hsa-miR-378f	PAR-CLIP	21572407
MIRT543139	hsa-miR-378h	PAR-CLIP	21572407
MIRT543138	hsa-miR-378i	PAR-CLIP	21572407
MIRT543137	hsa-miR-422a	PAR-CLIP	21572407
MIRT543136	hsa-miR-6503-3p	PAR-CLIP	21572407
MIRT543135	hsa-miR-6873-3p	PAR-CLIP	21572407
MIRT543134	hsa-miR-3191-5p	PAR-CLIP	21572407
MIRT442870	hsa-miR-365a-3p	PAR-CLIP	22100165
MIRT442869	hsa-miR-365b-3p	PAR-CLIP	22100165
MIRT442868	hsa-miR-4757-3p	PAR-CLIP	22100165
MIRT442867	hsa-miR-654-3p	PAR-CLIP	22100165
MIRT442866	hsa-miR-4742-3p	PAR-CLIP	22100165
MIRT442865	hsa-miR-496	PAR-CLIP	22100165
MIRT442864	hsa-miR-155-5p	PAR-CLIP	22100165
MIRT442863	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT755928	hsa-miR-142-3p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays	35194440
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT776408	hsa-miR-3974	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776417	hsa-miR-183	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT776420	hsa-miR-2681	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776434	hsa-miR-564	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776438	hsa-miR-1243	CLIP-seq
MIRT776439	hsa-miR-1255a	CLIP-seq
MIRT776440	hsa-miR-1255b	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT776442	hsa-miR-3154	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776444	hsa-miR-3179	CLIP-seq
MIRT776445	hsa-miR-3185	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT776447	hsa-miR-3616-3p	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT776449	hsa-miR-374a	CLIP-seq
MIRT776450	hsa-miR-374b	CLIP-seq
MIRT776451	hsa-miR-3919	CLIP-seq
MIRT776408	hsa-miR-3974	CLIP-seq
MIRT776452	hsa-miR-4273	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776454	hsa-miR-4303	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT776456	hsa-miR-4445	CLIP-seq
MIRT776457	hsa-miR-4446-3p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776459	hsa-miR-4462	CLIP-seq
MIRT776460	hsa-miR-4504	CLIP-seq
MIRT776461	hsa-miR-4511	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776463	hsa-miR-4656	CLIP-seq
MIRT776464	hsa-miR-4677-5p	CLIP-seq
MIRT776465	hsa-miR-4709-3p	CLIP-seq
MIRT776466	hsa-miR-4717-5p	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT776468	hsa-miR-4747-5p	CLIP-seq
MIRT776469	hsa-miR-4756-3p	CLIP-seq
MIRT776470	hsa-miR-495	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776471	hsa-miR-548aa	CLIP-seq
MIRT776472	hsa-miR-548c-3p	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT776475	hsa-miR-633	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT776477	hsa-miR-891b	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq
MIRT1929178	hsa-miR-105	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT1929179	hsa-miR-1273	CLIP-seq
MIRT1929180	hsa-miR-1285	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT1929181	hsa-miR-136	CLIP-seq
MIRT1929182	hsa-miR-1470	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT1929183	hsa-miR-2277-3p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT1929185	hsa-miR-3074-5p	CLIP-seq
MIRT1929186	hsa-miR-3124-3p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776442	hsa-miR-3154	CLIP-seq
MIRT1929188	hsa-miR-3158-3p	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776444	hsa-miR-3179	CLIP-seq
MIRT1929190	hsa-miR-3180	CLIP-seq
MIRT1929191	hsa-miR-3180-3p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT1929192	hsa-miR-3187-5p	CLIP-seq
MIRT1929193	hsa-miR-3196	CLIP-seq
MIRT1929194	hsa-miR-3202	CLIP-seq
MIRT1929195	hsa-miR-3610	CLIP-seq
MIRT1929196	hsa-miR-3613-5p	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT1929198	hsa-miR-371-5p	CLIP-seq
MIRT1929199	hsa-miR-371b-5p	CLIP-seq
MIRT776449	hsa-miR-374a	CLIP-seq
MIRT776450	hsa-miR-374b	CLIP-seq
MIRT1929200	hsa-miR-378g	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT1929201	hsa-miR-4271	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT1929202	hsa-miR-4421	CLIP-seq
MIRT1929203	hsa-miR-4437	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT1929205	hsa-miR-4486	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT1929206	hsa-miR-455-3p	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT1929207	hsa-miR-4667-3p	CLIP-seq
MIRT1929208	hsa-miR-4674	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT1929211	hsa-miR-4716-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT1929213	hsa-miR-4723-5p	CLIP-seq
MIRT1929214	hsa-miR-4725-3p	CLIP-seq
MIRT1929215	hsa-miR-4728-5p	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929217	hsa-miR-4738-5p	CLIP-seq
MIRT1929218	hsa-miR-4740-3p	CLIP-seq
MIRT776468	hsa-miR-4747-5p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT1929221	hsa-miR-4768-5p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT1929222	hsa-miR-501-3p	CLIP-seq
MIRT1929223	hsa-miR-502-3p	CLIP-seq
MIRT1929224	hsa-miR-539	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT1929226	hsa-miR-561	CLIP-seq
MIRT776434	hsa-miR-564	CLIP-seq
MIRT1929227	hsa-miR-586	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT1929228	hsa-miR-612	CLIP-seq
MIRT776475	hsa-miR-633	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT1929229	hsa-miR-661	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT1929231	hsa-miR-942	CLIP-seq
MIRT1929178	hsa-miR-105	CLIP-seq
MIRT1929180	hsa-miR-1285	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT1929182	hsa-miR-1470	CLIP-seq
MIRT776400	hsa-miR-185	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT1929183	hsa-miR-2277-3p	CLIP-seq
MIRT776401	hsa-miR-302a	CLIP-seq
MIRT776402	hsa-miR-302b	CLIP-seq
MIRT776403	hsa-miR-302c	CLIP-seq
MIRT776404	hsa-miR-302d	CLIP-seq
MIRT776405	hsa-miR-302e	CLIP-seq
MIRT1929186	hsa-miR-3124-3p	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT1929192	hsa-miR-3187-5p	CLIP-seq
MIRT2169824	hsa-miR-3200-5p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT1929198	hsa-miR-371-5p	CLIP-seq
MIRT1929199	hsa-miR-371b-5p	CLIP-seq
MIRT776406	hsa-miR-372	CLIP-seq
MIRT776407	hsa-miR-373	CLIP-seq
MIRT1929200	hsa-miR-378g	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT2169825	hsa-miR-4281	CLIP-seq
MIRT776409	hsa-miR-4306	CLIP-seq
MIRT1929203	hsa-miR-4437	CLIP-seq
MIRT1929205	hsa-miR-4486	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776410	hsa-miR-4644	CLIP-seq
MIRT1929207	hsa-miR-4667-3p	CLIP-seq
MIRT1929208	hsa-miR-4674	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT2169826	hsa-miR-4726-3p	CLIP-seq
MIRT1929217	hsa-miR-4738-5p	CLIP-seq
MIRT1929221	hsa-miR-4768-5p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776411	hsa-miR-520a-3p	CLIP-seq
MIRT776412	hsa-miR-520b	CLIP-seq
MIRT776413	hsa-miR-520c-3p	CLIP-seq
MIRT776414	hsa-miR-520d-3p	CLIP-seq
MIRT776415	hsa-miR-520e	CLIP-seq
MIRT776474	hsa-miR-587	CLIP-seq
MIRT1929228	hsa-miR-612	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT776476	hsa-miR-656	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT1929231	hsa-miR-942	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT2472682	hsa-miR-296-5p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT2472683	hsa-miR-3200-3p	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT2472684	hsa-miR-3545-3p	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT776448	hsa-miR-369-3p	CLIP-seq
MIRT2472685	hsa-miR-374c	CLIP-seq
MIRT2472686	hsa-miR-3918	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT2472687	hsa-miR-4268	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT2472688	hsa-miR-4448	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT2472689	hsa-miR-4698	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT2472690	hsa-miR-4731-3p	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT2472691	hsa-miR-4801	CLIP-seq
MIRT2472692	hsa-miR-4803	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT776470	hsa-miR-495	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT2472693	hsa-miR-548ac	CLIP-seq
MIRT2472694	hsa-miR-548ae	CLIP-seq
MIRT2472695	hsa-miR-548aj	CLIP-seq
MIRT2472696	hsa-miR-548am	CLIP-seq
MIRT2472697	hsa-miR-548d-3p	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT2472698	hsa-miR-548x	CLIP-seq
MIRT2472699	hsa-miR-548z	CLIP-seq
MIRT1929227	hsa-miR-586	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT2472700	hsa-miR-655	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq
MIRT776437	hsa-miR-1227	CLIP-seq
MIRT776416	hsa-miR-1286	CLIP-seq
MIRT776441	hsa-miR-1294	CLIP-seq
MIRT776418	hsa-miR-1915	CLIP-seq
MIRT776419	hsa-miR-22	CLIP-seq
MIRT2472682	hsa-miR-296-5p	CLIP-seq
MIRT1929184	hsa-miR-298	CLIP-seq
MIRT776421	hsa-miR-3064-3p	CLIP-seq
MIRT776422	hsa-miR-3064-5p	CLIP-seq
MIRT776423	hsa-miR-3141	CLIP-seq
MIRT1929187	hsa-miR-3143	CLIP-seq
MIRT776424	hsa-miR-3158-5p	CLIP-seq
MIRT1929189	hsa-miR-3162-3p	CLIP-seq
MIRT776443	hsa-miR-3174	CLIP-seq
MIRT776425	hsa-miR-3184	CLIP-seq
MIRT776446	hsa-miR-338-3p	CLIP-seq
MIRT2472684	hsa-miR-3545-3p	CLIP-seq
MIRT1929195	hsa-miR-3610	CLIP-seq
MIRT1929197	hsa-miR-361-3p	CLIP-seq
MIRT776426	hsa-miR-3660	CLIP-seq
MIRT2472686	hsa-miR-3918	CLIP-seq
MIRT776427	hsa-miR-423-5p	CLIP-seq
MIRT776453	hsa-miR-4299	CLIP-seq
MIRT776455	hsa-miR-4435	CLIP-seq
MIRT1929204	hsa-miR-4446-5p	CLIP-seq
MIRT776458	hsa-miR-4456	CLIP-seq
MIRT776428	hsa-miR-4526	CLIP-seq
MIRT776429	hsa-miR-4643	CLIP-seq
MIRT776462	hsa-miR-4649-3p	CLIP-seq
MIRT776430	hsa-miR-4685-5p	CLIP-seq
MIRT1929209	hsa-miR-4690-3p	CLIP-seq
MIRT1929210	hsa-miR-4715-3p	CLIP-seq
MIRT776431	hsa-miR-4717-3p	CLIP-seq
MIRT1929212	hsa-miR-4719	CLIP-seq
MIRT776467	hsa-miR-4721	CLIP-seq
MIRT1929216	hsa-miR-4733-3p	CLIP-seq
MIRT1929219	hsa-miR-4755-5p	CLIP-seq
MIRT1929220	hsa-miR-4768-3p	CLIP-seq
MIRT776432	hsa-miR-4797-5p	CLIP-seq
MIRT776433	hsa-miR-492	CLIP-seq
MIRT1929225	hsa-miR-543	CLIP-seq
MIRT776473	hsa-miR-548q	CLIP-seq
MIRT776435	hsa-miR-642b	CLIP-seq
MIRT1929230	hsa-miR-665	CLIP-seq
MIRT776436	hsa-miR-759	CLIP-seq
MIRT776478	hsa-miR-921	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
APC	Repression	15888491
AR	Activation	11278645
AR	Repression	20589722
GLI1	Unknown	23580656
NFKB1	Repression	18031796
RELA	Repression	18031796
STAT3	Unknown	16007214
TP53	Repression	12485897

Show/Hide all(200)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001893	Process	Maternal placenta development	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	19057511
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	19850054
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	28341552
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IMP	18558630
GO:0004672	Function	Protein kinase activity	TAS	10570282
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	17030608
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10102273, 10983986, 11994271, 16139227, 16540465, 19667065, 32322062
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	28386764
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	21432781, 21711983
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005515	Function	Protein binding	IPI	10102273, 10983986, 11154276, 11438723, 11839802, 12176997, 12244133, 12791994, 16044149, 16139227, 16280327, 16282323, 16417524, 16525023, 16537421, 16792529, 17006541, 17577629, 17932490, 18191226, 18250332, 18292230, 18505846, 18562279, 18624398, 18650932, 18786403, 19162005, 191
GO:0005516	Function	Calmodulin binding	IDA	29104511
GO:0005524	Function	ATP binding	IC	11994271
GO:0005524	Function	ATP binding	IDA	16540465
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	19203586
GO:0005634	Component	Nucleus	IDA	20333297
GO:0005634	Component	Nucleus	TAS	21432781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19203586, 25190803
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	21432781
GO:0005739	Component	Mitochondrion	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	21045808
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	14749367, 19203586, 20333297
GO:0005886	Component	Plasma membrane	TAS	21432781
GO:0005911	Component	Cell-cell junction	IEA
GO:0005978	Process	Glycogen biosynthetic process	IEA
GO:0005979	Process	Regulation of glycogen biosynthetic process	IMP	8940145
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006412	Process	Translation	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IDA	11994271, 14749367, 23431171
GO:0006469	Process	Negative regulation of protein kinase activity	IMP	9373175
GO:0006469	Process	Negative regulation of protein kinase activity	ISS
GO:0006606	Process	Protein import into nucleus	IMP	16280327
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	10376602
GO:0006924	Process	Activation-induced cell death of T cells	IMP	14749367
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	Cellular response to DNA damage stimulus	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0007165	Process	Signal transduction	TAS	21432781
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	20878056
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10570282
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	IMP	26514923
GO:0007281	Process	Germ cell development	IEA
GO:0007568	Process	Aging	IEA
GO:0008283	Process	Cell population proliferation	TAS	21432781
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	10983986
GO:0008286	Process	Insulin receptor signaling pathway	IMP	8978681
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0008643	Process	Carbohydrate transport	IEA
GO:0009408	Process	Response to heat	TAS	10958679
GO:0010507	Process	Negative regulation of autophagy	IMP	18387192
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	18558630
GO:0010628	Process	Positive regulation of gene expression	IMP	28341552
GO:0010628	Process	Positive regulation of gene expression	ISS	18292230
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010748	Process	Negative regulation of long-chain fatty acid import across plasma membrane	IMP	16814735
GO:0010761	Process	Fibroblast migration	NAS	19126672
GO:0010763	Process	Positive regulation of fibroblast migration	IEA
GO:0010765	Process	Positive regulation of sodium ion transport	IEA
GO:0010907	Process	Positive regulation of glucose metabolic process	IMP	16814735
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IMP	10983986
GO:0010951	Process	Negative regulation of endopeptidase activity	IMP	18387192
GO:0010975	Process	Regulation of neuron projection development	ISS
GO:0014065	Process	Phosphatidylinositol 3-kinase signaling	IMP	26514923
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016242	Process	Negative regulation of macroautophagy	NAS	23778976
GO:0016301	Function	Kinase activity	IDA	14749367
GO:0016310	Process	Phosphorylation	IDA	20333297
GO:0016567	Process	Protein ubiquitination	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	16139227, 32322062
GO:0018105	Process	Peptidyl-serine phosphorylation	TAS	21711983
GO:0018107	Process	Peptidyl-threonine phosphorylation	IDA	20605787
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019899	Function	Enzyme binding	ISS
GO:0021510	Process	Spinal cord development	IEA
GO:0030027	Component	Lamellipodium	NAS	19126672
GO:0030030	Process	Cell projection organization	IEA
GO:0030154	Process	Cell differentiation	TAS	21432781
GO:0030163	Process	Protein catabolic process	IEA
GO:0030212	Process	Hyaluronan metabolic process	IEA
GO:0030235	Function	Nitric-oxide synthase regulator activity	IMP	10376603
GO:0030307	Process	Positive regulation of cell growth	IDA	19203586
GO:0030334	Process	Regulation of cell migration	IMP	19934221
GO:0030334	Process	Regulation of cell migration	TAS	21432781
GO:0031018	Process	Endocrine pancreas development	TAS
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	NAS	19126672
GO:0031295	Process	T cell costimulation	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	18292230
GO:0031641	Process	Regulation of myelination	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0031929	Process	TOR signaling	NAS	23778976
GO:0031982	Component	Vesicle	IDA	16792529
GO:0031999	Process	Negative regulation of fatty acid beta-oxidation	IMP	16814735
GO:0032079	Process	Positive regulation of endodeoxyribonuclease activity	IDA	20605787
GO:0032091	Process	Negative regulation of protein binding	IMP	18292230
GO:0032094	Process	Response to food	IEA
GO:0032148	Process	Activation of protein kinase B activity	TAS
GO:0032270	Process	Positive regulation of cellular protein metabolic process	ISS
GO:0032287	Process	Peripheral nervous system myelin maintenance	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IMP	16814735
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0032991	Component	Protein-containing complex	IDA	10983986, 20878056
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	19667065
GO:0034405	Process	Response to fluid shear stress	IMP	10376603
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	26514923
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0035556	Process	Intracellular signal transduction	IDA	14749367
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	21321938
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IEA
GO:0036064	Component	Ciliary basal body	IEA
GO:0038061	Process	NIK/NF-kappaB signaling	IMP	26514923
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IPI	7891724, 17554339
GO:0042803	Function	Protein homodimerization activity	IDA	10983986
GO:0042981	Process	Regulation of apoptotic process	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	19203586
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10983986
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	ISS
GO:0043276	Process	Anoikis	NAS	23778976
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	19203586
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043491	Process	Protein kinase B signaling	IMP	28341552
GO:0043491	Process	Protein kinase B signaling	TAS
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	20011604
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	10376603
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	8940145
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IMP	16814735
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	NAS	17925406
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IMP	18483258
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	TAS
GO:0045746	Process	Negative regulation of Notch signaling pathway	TAS
GO:0045792	Process	Negative regulation of cell size	IEA
GO:0045861	Process	Negative regulation of proteolysis	IMP	18387192
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	26514923
GO:0045907	Process	Positive regulation of vasoconstriction	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046326	Process	Positive regulation of glucose import	IMP	8940145, 16814735
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0046622	Process	Positive regulation of organ growth	IEA
GO:0046777	Process	Protein autophosphorylation	TAS	16280327
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IDA	32322062
GO:0046889	Process	Positive regulation of lipid biosynthetic process	IMP	8940145
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IMP	8978681
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21321938
GO:0050999	Process	Regulation of nitric-oxide synthase activity	TAS
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	IMP	10376603
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	19057511
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051721	Function	Protein phosphatase 2A binding	IEA
GO:0051898	Process	Negative regulation of protein kinase B signaling	TAS
GO:0060079	Process	Excitatory postsynaptic potential	NAS	21711983
GO:0060416	Process	Response to growth hormone	ISS
GO:0060644	Process	Mammary gland epithelial cell differentiation	TAS	21432781
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0070141	Process	Response to UV-A	IDA	18483258
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071276	Process	Cellular response to cadmium ion	IMP	26514923
GO:0071356	Process	Cellular response to tumor necrosis factor	IMP	10983986
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	IEA
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IEA
GO:0071407	Process	Cellular response to organic cyclic compound	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071889	Function	14-3-3 protein binding	IPI	10102273
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	TAS	28386764
GO:0072655	Process	Establishment of protein localization to mitochondrion	IMP	23962723
GO:0072656	Process	Maintenance of protein location in mitochondrion	IMP	23962723
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	ISS
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0100002	Process	Negative regulation of protein kinase activity by protein phosphorylation	TAS	21711983
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IMP	28341552
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	18483258
GO:1900182	Process	Positive regulation of protein localization to nucleus	IMP	20605787
GO:1901215	Process	Negative regulation of neuron death	NAS	18221368
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	NAS	16604263
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	28341552
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	8940145
GO:1903721	Process	Positive regulation of I-kappaB phosphorylation	IMP	26514923
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IMP	20605787
GO:1990418	Process	Response to insulin-like growth factor stimulus	ISS
GO:2000010	Process	Positive regulation of protein localization to cell surface	IEA
GO:2000402	Process	Negative regulation of lymphocyte migration	IMP	28341552
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	TAS	10748004

MIM	HGNC	e!Ensembl
164730	391	ENSG00000142208

Protein

UniProt ID

P31749

Protein name

RAC-alpha serine/threonine-protein kinase (EC 2.7.11.1) (Protein kinase B) (PKB) (Protein kinase B alpha) (PKB alpha) (Proto-oncogene c-Akt) (RAC-PK-alpha)

Protein function

AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis (PubMed:11882383, PubMed

PDB

1H10 , 1UNP , 1UNQ , 1UNR , 2UVM , 2UZR , 2UZS , 3CQU , 3CQW , 3MV5 , 3MVH , 3O96 , 3OCB , 3OW4 , 3QKK , 3QKL , 3QKM , 4EJN , 4EKK , 4EKL , 4GV1 , 5KCV , 6BUU , 6CCY , 6HHF , 6HHG , 6HHH , 6HHI , 6HHJ , 6NPZ , 6S9W , 6S9X , 7APJ , 7MYX , 7NH4 , 7NH5 , 8JOW , 8UVY , 8UW2 , 8UW7 , 8UW9 , 8ZPU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00169	PH	6 → 108	PH domain	Domain
PF00069	Pkinase	150 → 408	Protein kinase domain	Domain
PF00433	Pkinase_C	429 → 474	Protein kinase C terminal domain	Family

Sequence

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

Sequence length

480

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412