AGTR2 (angiotensin II receptor type 2)

Gene

• Entrez ID: 186
• Gene name: Angiotensin II receptor type 2
• Gene symbol: AGTR2
• Synonyms: AT2, ATGR2, MRX88
• Chromosome: X
• Chromosome location: Xq23
• Summary: The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus and in neonates, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked cognitive disability. Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) and SARS-CoV-2 infection results in down-regulation of angiotensin converting enzyme-2 (ACE2) receptors, the effects of which, triggers serious inflammatory lesions in the tissues involved, primarily in the lungs. The inflammatory reaction appears to be mediated by angiotensin II derivatives, including the angiotensin AT2 receptor which has been found to be upregulated in bronchoalveolar lavage samples from Coronavirus disease 2019 (COVID19) patients. [provided by RefSeq, Jul 2020]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019253	hsa-miR-148b-3p	Microarray	17612493
MIRT021590	hsa-miR-142-3p	Microarray	17612493
MIRT022332	hsa-miR-124-3p	Microarray	18668037
MIRT528486	hsa-miR-5706	PAR-CLIP	22012620
MIRT528488	hsa-miR-4782-5p	PAR-CLIP	22012620
MIRT528489	hsa-miR-516b-5p	PAR-CLIP	22012620
MIRT528490	hsa-miR-1299	PAR-CLIP	22012620
MIRT528491	hsa-miR-1468-3p	PAR-CLIP	22012620
MIRT528492	hsa-miR-6839-5p	PAR-CLIP	22012620
MIRT528493	hsa-miR-378j	PAR-CLIP	22012620
MIRT528494	hsa-miR-548p	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001974	Process	Blood vessel remodeling	TAS	17159080
GO:0001991	Process	Regulation of systemic arterial blood pressure by circulatory renin-angiotensin	ISS
GO:0002018	Process	Renin-angiotensin regulation of aldosterone production	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004945	Function	Angiotensin type II receptor activity	IBA	21873635
GO:0004945	Function	Angiotensin type II receptor activity	IPI	10406457
GO:0005515	Function	Protein binding	IPI	10406457, 18344519, 23597562
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IC	10406457
GO:0006883	Process	Cellular sodium ion homeostasis	IEA
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10406457
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IC	10406457
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007199	Process	G protein-coupled receptor signaling pathway coupled to cGMP nucleotide second messenger	ISS	17000928
GO:0007263	Process	Nitric oxide mediated signal transduction	IC	17000928
GO:0007263	Process	Nitric oxide mediated signal transduction	TAS	17159080
GO:0007420	Process	Brain development	NAS	12089445
GO:0008134	Function	Transcription factor binding	IEA
GO:0008217	Process	Regulation of blood pressure	TAS	7477266
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010459	Process	Negative regulation of heart rate	ISS
GO:0010700	Process	Negative regulation of norepinephrine secretion	IEA
GO:0021695	Process	Cerebellar cortex development	IEA
GO:0030308	Process	Negative regulation of cell growth	TAS	17159080
GO:0032304	Process	Negative regulation of icosanoid secretion	IEA
GO:0032516	Process	Positive regulation of phosphoprotein phosphatase activity	IDA	10406457
GO:0035556	Process	Intracellular signal transduction	ISS	17000928
GO:0035815	Process	Positive regulation of renal sodium excretion	IEA
GO:0035932	Process	Aldosterone secretion	IEA
GO:0038166	Process	Angiotensin-activated signaling pathway	IEA
GO:0042306	Process	Regulation of protein import into nucleus	IEA
GO:0042311	Process	Vasodilation	IDA	15117835, 17159079
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	NAS	15710780
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IC	17000928
GO:0048019	Function	Receptor antagonist activity	TAS	17159079
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	ISS	17000928
GO:0051387	Process	Negative regulation of neurotrophin TRK receptor signaling pathway	IMP	10406457
GO:0060993	Process	Kidney morphogenesis	IEA
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	10406457

Other IDs

• MIM: 300034
• HGNC: 338
• e!Ensembl: ENSG00000180772

Protein

• UniProt ID: P50052
• Protein name: Type-2 angiotensin II receptor (Angiotensin II type-2 receptor) (AT2)
• Protein function: Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.
• PDB: 5UNF, 5UNG, 5UNH, 6JOD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	61 → 318	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
  VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
  GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
  FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
  TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
  PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
  FVS

• Sequence length: 363