AGRP (agouti related neuropeptide)

Gene

• Entrez ID: 181
• Gene name: Agouti related neuropeptide
• Gene symbol: AGRP
• Synonyms: AGRT, ART, ASIP2
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostas

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018298	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	10318826
GO:0005184	Function	Neuropeptide hormone activity	IBA	21873635
GO:0005184	Function	Neuropeptide hormone activity	IDA	15927146
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	15927146
GO:0005796	Component	Golgi lumen	IDA	15927146
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15927146
GO:0007623	Process	Circadian rhythm	IEA
GO:0007631	Process	Feeding behavior	TAS	9751529
GO:0008343	Process	Adult feeding behavior	IBA	21873635
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0031779	Function	Melanocortin receptor binding	IBA	21873635
GO:0032868	Process	Response to insulin	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0048571	Process	Long-day photoperiodism	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060259	Process	Regulation of feeding behavior	IDA	15927146
GO:0060259	Process	Regulation of feeding behavior	IMP	9311920
GO:0070996	Function	Type 1 melanocortin receptor binding	IBA	21873635
GO:2000253	Process	Positive regulation of feeding behavior	IBA	21873635

Other IDs

• MIM: 602311
• HGNC: 330
• e!Ensembl: ENSG00000159723

Protein

• UniProt ID: O00253
• Protein name: Agouti-related protein
• Protein function: Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocorti
• PDB: 1HYK, 1MR0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05039	Agouti	34 → 122	Agouti protein	Family

• Sequence:

  MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
  EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
  KLGTAMNPCSRT

• Sequence length: 132