AGRP (agouti related neuropeptide)

Gene

• Entrez ID: 181
• Gene name: Agouti related neuropeptide
• Gene symbol: AGRP
• Synonyms: AGRT, ART, ASIP2
• Chromosome: 16
• Chromosome location: 16q22.1
• Summary: This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018298	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	10318826
GO:0005184	Function	Neuropeptide hormone activity	IBA	21873635
GO:0005184	Function	Neuropeptide hormone activity	IDA	15927146
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	15927146
GO:0005796	Component	Golgi lumen	IDA	15927146
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15927146
GO:0007623	Process	Circadian rhythm	IEA
GO:0007631	Process	Feeding behavior	TAS	9751529
GO:0008343	Process	Adult feeding behavior	IBA	21873635
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0031779	Function	Melanocortin receptor binding	IBA	21873635
GO:0032868	Process	Response to insulin	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0048571	Process	Long-day photoperiodism	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060259	Process	Regulation of feeding behavior	IDA	15927146
GO:0060259	Process	Regulation of feeding behavior	IMP	9311920
GO:0070996	Function	Type 1 melanocortin receptor binding	IBA	21873635
GO:2000253	Process	Positive regulation of feeding behavior	IBA	21873635

Other IDs

• MIM: 602311
• HGNC: 330
• e!Ensembl: ENSG00000159723

Protein

• UniProt ID: O00253
• Protein name: Agouti-related protein
• Protein function: Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R (By similarity). Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.
• PDB: 1HYK, 1MR0, 2IQV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05039	Agouti	34 → 122	Agouti protein	Family

• Sequence:

  MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAE
  EDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCR
  KLGTAMNPCSRT

• Sequence length: 132