ADSS1 (adenylosuccinate synthase 1)

Gene

• Entrez ID: 122622
• Gene name: Adenylosuccinate synthase 1
• Gene symbol: ADSS1
• Synonyms: ADSSL1, MPD5
• Chromosome: 14
• Chromosome location: 14q32.33
• Summary: This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent onset distal myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018589	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IEA
GO:0002376	Process	Immune system process	NAS	15786719
GO:0003924	Function	GTPase activity	IEA
GO:0004019	Function	Adenylosuccinate synthase activity	IBA	21873635
GO:0004019	Function	Adenylosuccinate synthase activity	IDA	15786719
GO:0004019	Function	Adenylosuccinate synthase activity	IMP	26506222
GO:0005525	Function	GTP binding	NAS	15786719
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	15786719
GO:0005829	Component	Cytosol	TAS
GO:0006167	Process	AMP biosynthetic process	IDA	15786719
GO:0006531	Process	Aspartate metabolic process	IEA
GO:0006541	Process	Glutamine metabolic process	IEA
GO:0009168	Process	Purine ribonucleoside monophosphate biosynthetic process	TAS
GO:0014850	Process	Response to muscle activity	IEA
GO:0035690	Process	Cellular response to drug	IEA
GO:0042301	Function	Phosphate ion binding	NAS	15786719
GO:0042594	Process	Response to starvation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0044208	Process	'de novo' AMP biosynthetic process	IBA	21873635
GO:0044208	Process	'de novo' AMP biosynthetic process	IEA
GO:0046040	Process	IMP metabolic process	IBA	21873635
GO:0051015	Function	Actin filament binding	IEA
GO:0071257	Process	Cellular response to electrical stimulus	IEA

Other IDs

• MIM: 612498
• HGNC: 20093
• e!Ensembl: ENSG00000185100

Protein

• UniProt ID: Q8N142
• Protein name: Adenylosuccinate synthetase isozyme 1 (AMPSase 1) (AdSS 1) (EC 6.3.4.4) (Adenylosuccinate synthetase, basic isozyme) (Adenylosuccinate synthetase, muscle isozyme) (M-type adenylosuccinate synthetase) (Adenylosuccinate synthetase-like 1) (AdSSL1) (IMP--aspartate ligase 1)
• Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.
• PDB: 2GJO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00709	Adenylsucc_synt	34 → 454	Adenylosuccinate synthetase	Domain

• Sequence:

  MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADII
  SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKG
  LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGL
  RICDLLSDFDEFSSRFKNLAHQHQSMFPTLEIDIEGQLKRLKGFAERIRPMVRDGVYFMY
  EALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKA
  YTTRVGIGAFPTEQINEIGGLLQTRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
  LTKLDILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWE
  DLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF

• Sequence length: 457