ADRA1D (adrenoceptor alpha 1D)

Gene

• Entrez ID: 146
• Gene name: Adrenoceptor alpha 1D
• Gene symbol: ADRA1D
• Synonyms: ADRA1, ADRA1A, ADRA1R, ALPHA1, DAR, dJ779E11.2
• Chromosome: 20
• Chromosome location: 20p13
• Summary: Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1D-adrenergic receptor. Similar to alpha-1B-adrenergic receptor gene, this gene comprises 2 exons and a single intron that interrupts the coding region. [provided by RefSeq, Jul 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001996	Process	Positive regulation of heart rate by epinephrine-norepinephrine	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004937	Function	Alpha1-adrenergic receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16533813, 18468998, 21115837, 24550280, 26460884, 26617989, 27382054, 28862946, 29426850
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10820200
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007267	Process	Cell-cell signaling	IBA	21873635
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10860850
GO:0042802	Function	Identical protein binding	IPI	14645668, 26617989, 27382054
GO:0043410	Process	Positive regulation of MAPK cascade	IBA	21873635
GO:0045907	Process	Positive regulation of vasoconstriction	IBA	21873635
GO:0071880	Process	Adenylate cyclase-activating adrenergic receptor signaling pathway	IBA	21873635
GO:0150099	Process	Neuron-glial cell signaling	ISS

Other IDs

• MIM: 104219
• HGNC: 280
• e!Ensembl: ENSG00000171873

Protein

• UniProt ID: P25100
• Protein name: Alpha-1D adrenergic receptor (Alpha-1A adrenergic receptor) (Alpha-1D adrenoreceptor) (Alpha-1D adrenoceptor) (Alpha-adrenergic receptor 1a)
• Protein function: This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	113 → 402	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
  SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
  VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
  TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
  PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
  EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
  WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
  CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
  QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
  AVSLGVPHEVAEGATCQAYELADYSNLRETDI

• Sequence length: 572