ADIPOR1 (adiponectin receptor 1)

Gene

• Entrez ID: 51094
• Gene name: Adiponectin receptor 1
• Gene symbol: ADIPOR1
• Synonyms: ACDCR1, CGI-45, CGI45, PAQR1, TESBP1A
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT048047	hsa-miR-197-3p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
ATF3	Repression	20696134
FOXO1	Activation	20125105

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	19233263
GO:0005886	Component	Plasma membrane	TAS
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	12802337
GO:0010633	Process	Negative regulation of epithelial cell migration	IMP	23776679
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IMP	23776679
GO:0010906	Process	Regulation of glucose metabolic process	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016021	Component	Integral component of membrane	IEA
GO:0019216	Process	Regulation of lipid metabolic process	ISS
GO:0019395	Process	Fatty acid oxidation	IDA	12802337
GO:0019901	Function	Protein kinase binding	IPI	19233263
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0031226	Component	Intrinsic component of plasma membrane	IDA	12802337
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0033211	Process	Adiponectin-activated signaling pathway	IBA	21873635
GO:0033211	Process	Adiponectin-activated signaling pathway	IDA	12802337
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0042304	Process	Regulation of fatty acid biosynthetic process	TAS
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	23776679
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0055100	Function	Adiponectin binding	IDA	12802337
GO:0097003	Function	Adipokinetic hormone receptor activity	IDA	12802337
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24531262
GO:1901223	Process	Negative regulation of NIK/NF-kappaB signaling	IMP	23776679

Other IDs

• MIM: 607945
• HGNC: 24040
• e!Ensembl: ENSG00000159346

Protein

• UniProt ID: Q96A54
• Protein name: Adiponectin receptor protein 1 (Progestin and adipoQ receptor family member 1) (Progestin and adipoQ receptor family member I)
• Protein function: Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:25855295, PubMed:12802337). Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin (By similarity).
• PDB: 5LXG, 6KRZ, 6KS0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03006	HlyIII	129 → 352	Haemolysin-III related	Family

• Sequence:

  MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEE
  EEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPS
  FRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGA
  VLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLS
  IVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQM
  GWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQE
  FRYGLEGGCTDDTLL

• Sequence length: 375