ADH7 (alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide)

Gene

• Entrez ID: 131
• Gene name: Alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
• Gene symbol: ADH7
• Synonyms: ADH4
• Chromosome: 4
• Chromosome location: 4q23
• Summary: This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018740	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IDA	9600267, 16787387
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	TAS	8074657
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IBA	21873635
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IDA	7876099
GO:0004031	Function	Aldehyde oxidase activity	IDA	9600267
GO:0004745	Function	Retinol dehydrogenase activity	IBA	21873635
GO:0004745	Function	Retinol dehydrogenase activity	IDA	7876099, 9600267, 11997393, 15369820, 16787387
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006068	Process	Ethanol catabolic process	IEA
GO:0006069	Process	Ethanol oxidation	IBA	21873635
GO:0006069	Process	Ethanol oxidation	IDA	7876099, 10969996
GO:0006069	Process	Ethanol oxidation	TAS
GO:0008270	Function	Zinc ion binding	IBA	21873635
GO:0009617	Process	Response to bacterium	IDA	11410738
GO:0010430	Process	Fatty acid omega-oxidation	IDA	9600267
GO:0019841	Function	Retinol binding	IDA	9228021
GO:0035276	Function	Ethanol binding	IDA	9228021
GO:0042572	Process	Retinol metabolic process	IBA	21873635
GO:0042573	Process	Retinoic acid metabolic process	IBA	21873635
GO:0045471	Process	Response to ethanol	IDA	9600267
GO:0048019	Function	Receptor antagonist activity	IDA	9600267
GO:0050153	Function	Omega-hydroxydecanoate dehydrogenase activity	IEA
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA

Other IDs

• MIM: 600086
• HGNC: 256
• e!Ensembl: ENSG00000196344

Protein

• UniProt ID: P40394
• Protein name: All-trans-retinol dehydrogenase [NAD(+)] ADH7 (EC 1.1.1.105) (Alcohol dehydrogenase class 4 mu/sigma chain) (EC 1.1.1.1) (Alcohol dehydrogenase class IV mu/sigma chain) (Gastric alcohol dehydrogenase) (Omega-hydroxydecanoate dehydrogenase ADH7) (EC 1.1.1.66) (Retinol dehydrogenase)
• Protein function: Catalyzes the NAD-dependent oxidation of all-trans-retinol, alcohol, and omega-hydroxy fatty acids and their derivatives (PubMed:15369820, PubMed:16787387, PubMed:9600267). Oxidizes preferentially all trans-retinol, all-trans-4-hydroxyretinol, 9-cis-retinol, 2-hexenol, and long chain omega-hydroxy fatty acids such as juniperic acid (PubMed:15369820, PubMed:16787387, PubMed:9600267). In vitro can also catalyzes the NADH-dependent reduction of all-trans-retinal and aldehydes and their derivatives (PubMed:15369820, PubMed:16787387, PubMed:9600267). Reduces preferentially all trans-retinal, all-trans-4-oxoretinal and hexanal (PubMed:15369820, PubMed:16787387). Catalyzes in the oxidative direction with higher efficiency (PubMed:16787387, PubMed:15369820). Therefore may participate in retinoid metabolism, fatty acid omega-oxidation, and elimination of cytotoxic aldehydes produced by lipid peroxidation (PubMed:9600267, PubMed:15369820, PubMed:16787387).
• PDB: 1AGN, 1D1S, 1D1T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08240	ADH_N	46 → 172	Alcohol dehydrogenase GroES-like domain	Domain
  PF00107	ADH_zinc_N	214 → 350	Zinc-binding dehydrogenase	Family

• Sequence:

  MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
  TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
  GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
  VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
  FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
  SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
  VLPFKKISEGFELLNSGQSIRTVLTF

• Sequence length: 386