ADH7 (alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide)

Gene

• Entrez ID: 131
• Gene name: Alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
• Gene symbol: ADH7
• Synonyms: ADH4
• Chromosome: 4
• Chromosome location: 4q23
• Summary: This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxyste

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018740	hsa-miR-335-5p	Microarray	18185580
MIRT755738	hsa-miR-21-5p	qRT-PCR	35235474
MIRT768708	hsa-miR-1	CLIP-seq
MIRT768709	hsa-miR-206	CLIP-seq
MIRT768710	hsa-miR-3545-3p	CLIP-seq
MIRT768711	hsa-miR-3673	CLIP-seq
MIRT768712	hsa-miR-4698	CLIP-seq
MIRT768713	hsa-miR-607	CLIP-seq
MIRT768714	hsa-miR-613	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001523	Process	Retinoid metabolic process	IDA	9600267, 16787387
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	TAS	8074657
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IBA	21873635
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IDA	7876099
GO:0004031	Function	Aldehyde oxidase activity	IDA	9600267
GO:0004745	Function	Retinol dehydrogenase activity	IBA	21873635
GO:0004745	Function	Retinol dehydrogenase activity	IDA	7876099, 9600267, 11997393, 15369820, 16787387
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006068	Process	Ethanol catabolic process	IEA
GO:0006069	Process	Ethanol oxidation	IBA	21873635
GO:0006069	Process	Ethanol oxidation	IDA	7876099, 10969996
GO:0006069	Process	Ethanol oxidation	TAS
GO:0008270	Function	Zinc ion binding	IBA	21873635
GO:0009617	Process	Response to bacterium	IDA	11410738
GO:0010430	Process	Fatty acid omega-oxidation	IDA	9600267
GO:0019841	Function	Retinol binding	IDA	9228021
GO:0035276	Function	Ethanol binding	IDA	9228021
GO:0042572	Process	Retinol metabolic process	IBA	21873635
GO:0042573	Process	Retinoic acid metabolic process	IBA	21873635
GO:0045471	Process	Response to ethanol	IDA	9600267
GO:0048019	Function	Receptor antagonist activity	IDA	9600267
GO:0050153	Function	Omega-hydroxydecanoate dehydrogenase activity	IEA
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA

Other IDs

• MIM: 600086
• HGNC: 256
• e!Ensembl: ENSG00000196344

Protein

• UniProt ID: P40394
• Protein name: All-trans-retinol dehydrogenase [NAD(+)] ADH7 (EC 1.1.1.105) (Alcohol dehydrogenase class 4 mu/sigma chain) (EC 1.1.1.1) (Alcohol dehydrogenase class IV mu/sigma chain) (Gastric alcohol dehydrogenase) (Omega-hydroxydecanoate dehydrogenase ADH7) (EC 1.1.1.
• Protein function: Catalyzes the NAD-dependent oxidation of all-trans-retinol, alcohol, and omega-hydroxy fatty acids and their derivatives (PubMed:15369820, PubMed:16787387, PubMed:9600267). Oxidizes preferentially all trans-retinol, all-trans-4-hydroxyretinol, 9
• PDB: 1AGN, 1D1S, 1D1T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08240	ADH_N	46 → 172	Alcohol dehydrogenase GroES-like domain	Domain
  PF00107	ADH_zinc_N	214 → 350	Zinc-binding dehydrogenase	Family

• Sequence:

  MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
  TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
  GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
  VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
  FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
  SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
  VLPFKKISEGFELLNSGQSIRTVLTF

• Sequence length: 386