ADH1C (alcohol dehydrogenase 1C (class I), gamma polypeptide)

Gene

• Entrez ID: 126
• Gene name: Alcohol dehydrogenase 1C (class I), gamma polypeptide
• Gene symbol: ADH1C
• Synonyms: ADH3
• Chromosome: 4
• Chromosome location: 4q23
• Summary: This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation to acetaldehyde, thus playing a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. An association between ADH1C polymorphism and alcohol dependence has not been established. [provided by RefSeq, Sep 2019]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs283413	C>A,T	Benign, risk-factor	Coding sequence variant, missense variant, stop gained, non coding transcript variant

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004022	Function	Alcohol dehydrogenase (NAD+) activity	IDA	6391957
GO:0004024	Function	Alcohol dehydrogenase activity, zinc-dependent	IBA	21873635
GO:0004745	Function	Retinol dehydrogenase activity	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006069	Process	Ethanol oxidation	IBA	21873635
GO:0006069	Process	Ethanol oxidation	IDA	6391957
GO:0006069	Process	Ethanol oxidation	TAS
GO:0008270	Function	Zinc ion binding	IBA	21873635
GO:0042572	Process	Retinol metabolic process	IBA	21873635
GO:0042573	Process	Retinoic acid metabolic process	IBA	21873635

Other IDs

• MIM: 103730
• HGNC: 251
• e!Ensembl: ENSG00000248144

Protein

• UniProt ID: P00326
• Protein name: Alcohol dehydrogenase 1C (EC 1.1.1.1) (Alcohol dehydrogenase subunit gamma)
• PDB: 1DDA, 1HT0, 1U3W
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08240	ADH_N	34 → 161	Alcohol dehydrogenase GroES-like domain	Domain
  PF00107	ADH_zinc_N	203 → 339	Zinc-binding dehydrogenase	Family

• Sequence:

  MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
  PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
  RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
  YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
  CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
  NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
  DLLRSGKSIRTVLTF

• Sequence length: 375