ADCY7 (adenylate cyclase 7)

Gene

• Entrez ID: 113
• Gene name: Adenylate cyclase 7
• Gene symbol: ADCY7
• Synonyms: AC7
• Chromosome: 16
• Chromosome location: 16q12.1
• Summary: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. Several transcript variants have been observed for this gene, but the full-length natures of only two have been determined so far. [provided by RefSeq, Oct 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018909	hsa-miR-335-5p	Microarray	18185580
MIRT527556	hsa-miR-4776-3p	PAR-CLIP	22012620
MIRT527557	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT527558	hsa-miR-874-3p	PAR-CLIP	22012620
MIRT527559	hsa-miR-3157-3p	PAR-CLIP	22012620
MIRT527560	hsa-miR-4659a-5p	PAR-CLIP	22012620
MIRT527561	hsa-miR-4659b-5p	PAR-CLIP	22012620
MIRT527562	hsa-miR-5590-5p	PAR-CLIP	22012620
MIRT527563	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT527564	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT527565	hsa-miR-6886-3p	PAR-CLIP	22012620
MIRT527566	hsa-miR-938	PAR-CLIP	22012620
MIRT527567	hsa-miR-338-3p	PAR-CLIP	22012620
MIRT527568	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT527569	hsa-miR-4310	PAR-CLIP	22012620
MIRT527570	hsa-miR-302f	PAR-CLIP	22012620
MIRT527571	hsa-miR-634	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002819	Process	Regulation of adaptive immune response	ISS
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004016	Function	Adenylate cyclase activity	IBA	21873635
GO:0004016	Function	Adenylate cyclase activity	IDA	11113152, 17760784
GO:0004016	Function	Adenylate cyclase activity	IMP	18541530, 23178822, 23229509, 23842570
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006171	Process	CAMP biosynthetic process	IDA	11113152, 17760784
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	TAS
GO:0007190	Process	Activation of adenylate cyclase activity	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0016021	Component	Integral component of membrane	IDA	11113152
GO:0034199	Process	Activation of protein kinase A activity	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0071285	Process	Cellular response to lithium ion	ISS
GO:0071361	Process	Cellular response to ethanol	IDA	12454008, 17760784
GO:0071377	Process	Cellular response to glucagon stimulus	TAS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS

Other IDs

• MIM: 600385
• HGNC: 238
• e!Ensembl: ENSG00000121281

Protein

• UniProt ID: P51828
• Protein name: Adenylate cyclase type 7 (EC 4.6.1.1) (ATP pyrophosphate-lyase 7) (Adenylate cyclase type VII) (Adenylyl cyclase 7)
• Protein function: Catalyzes the formation of cAMP in response to activation of G protein-coupled receptors (Probable). Functions in signaling cascades activated namely by thrombin and sphingosine 1-phosphate and mediates regulation of cAMP synthesis through synergistic action of the stimulatory G alpha protein with GNA13 (PubMed:23229509, PubMed:18541530). Also, during inflammation, mediates zymosan-induced increase intracellular cAMP, leading to protein kinase A pathway activation in order to modulate innate immune responses through heterotrimeric G proteins G(12/13) (By similarity). Functions in signaling cascades activated namely by dopamine and C5 alpha chain and mediates regulation of cAMP synthesis through synergistic action of the stimulatory G protein with G beta:gamma complex (PubMed:23842570, PubMed:23229509). Functions, through cAMP response regulation, to keep inflammation under control during bacterial infection by sensing the presence of serum factors, such as the bioactive lysophospholipid (LPA) that regulate LPS-induced TNF-alpha production. However, it is also required for the optimal functions of B and T cells during adaptive immune responses by regulating cAMP synthesis in both B and T cells (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16214	AC_N	15 → 256	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
  PF00211	Guanylate_cyc	270 → 447	Adenylate and Guanylate cyclase catalytic domain	Domain
  PF06327	DUF1053	485 → 593	Domain of Unknown Function (DUF1053)	Family
  PF00211	Guanylate_cyc	870 → 1069	Adenylate and Guanylate cyclase catalytic domain	Domain

• Sequence:

  MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
  RHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
  CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
  LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
  ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
  VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
  VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
  LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
  SVRMTRYLESWGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRS
  EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
  SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
  VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLLAASSKTRALCEPLP
  YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKP
  NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
  MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
  GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
  IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
  RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
  

• Sequence length: 1080