ADCY6 (adenylate cyclase 6)

Gene

• Entrez ID: 112
• Gene name: Adenylate cyclase 6
• Gene symbol: ADCY6
• Synonyms: AC6, LCCS8
• Chromosome: 12
• Chromosome location: 12q13.12
• Summary: This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic loop, and a C-terminal cytoplasmic domain. The two cytoplasmic regions bind ATP and form the catalytic core of the protein. Adenylyl cyclases are important effectors of transmembrane signaling pathways and are regulated by the activity of G protein coupled receptor signaling. This protein belongs to a small subclass of adenylyl cyclase proteins that are functionally related and are inhibited by protein kinase A, calcium ions and nitric oxide. A mutation in this gene is associated with arthrogryposis multiplex congenita. [provided by RefSeq, May 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001991	hsa-miR-96-5p	Luciferase reporter assay	17597072
MIRT001991	hsa-miR-96-5p	Sequencing	20371350
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay	17597072
MIRT001992	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	20656788
MIRT016723	hsa-miR-335-5p	Microarray	18185580
MIRT022147	hsa-miR-124-3p	Microarray	18668037
MIRT660895	hsa-miR-6885-3p	HITS-CLIP	23824327
MIRT660896	hsa-miR-5089-3p	HITS-CLIP	23824327
MIRT660897	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660898	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT660899	hsa-miR-4287	HITS-CLIP	23824327
MIRT660900	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT660901	hsa-miR-3183	HITS-CLIP	23824327
MIRT660902	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT660903	hsa-miR-483-3p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003091	Process	Renal water homeostasis	ISS
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004016	Function	Adenylate cyclase activity	IBA	21873635
GO:0004016	Function	Adenylate cyclase activity	IDA	17916776, 18403039, 23842570
GO:0005080	Function	Protein kinase C binding	IDA	17081159
GO:0005515	Function	Protein binding	IPI	17081159
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005929	Component	Cilium	IEA
GO:0006171	Process	CAMP biosynthetic process	IBA	21873635
GO:0006171	Process	CAMP biosynthetic process	IDA	17916776, 18403039
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17916776
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	TAS
GO:0007190	Process	Activation of adenylate cyclase activity	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS
GO:0007212	Process	Dopamine receptor signaling pathway	IDA	18403039
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	ISS
GO:0019901	Function	Protein kinase binding	ISS
GO:0031226	Component	Intrinsic component of plasma membrane	ISS
GO:0032420	Component	Stereocilium	IEA
GO:0034199	Process	Activation of protein kinase A activity	TAS
GO:0035811	Process	Negative regulation of urine volume	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0071377	Process	Cellular response to glucagon stimulus	TAS
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IDA	18403039
GO:0071870	Process	Cellular response to catecholamine stimulus	IDA	18403039
GO:0097746	Process	Blood vessel diameter maintenance	IMP	17916776
GO:1904117	Process	Cellular response to vasopressin	ISS
GO:1904322	Process	Cellular response to forskolin	IDA	17916776

Other IDs

• MIM: 600294
• HGNC: 237
• e!Ensembl: ENSG00000174233

Protein

• UniProt ID: O43306
• Protein name: Adenylate cyclase type 6 (EC 4.6.1.1) (ATP pyrophosphate-lyase 6) (Adenylate cyclase type VI) (Adenylyl cyclase 6) (Ca(2+)-inhibitable adenylyl cyclase)
• Protein function: Catalyzes the formation of the signaling molecule cAMP downstream of G protein-coupled receptors (PubMed:17916776, PubMed:17110384). Functions in signaling cascades downstream of beta-adrenergic receptors in the heart and in vascular smooth muscle cells (PubMed:17916776). Functions in signaling cascades downstream of the vasopressin receptor in the kidney and has a role in renal water reabsorption. Functions in signaling cascades downstream of PTH1R and plays a role in regulating renal phosphate excretion. Functions in signaling cascades downstream of the VIP and SCT receptors in pancreas and contributes to the regulation of pancreatic amylase and fluid secretion (By similarity). Signaling mediates cAMP-dependent activation of protein kinase PKA. This promotes increased phosphorylation of various proteins, including AKT. Plays a role in regulating cardiac sarcoplasmic reticulum Ca(2+) uptake and storage, and is required for normal heart ventricular contractibility. May contribute to normal heart function (By similarity). Mediates vasodilatation after activation of beta-adrenergic receptors by isoproterenol (PubMed:17916776). Contributes to bone cell responses to mechanical stimuli (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16214	AC_N	11 → 368	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
  PF00211	Guanylate_cyc	370 → 553	Adenylate and Guanylate cyclase catalytic domain	Domain
  PF06327	DUF1053	580 → 669	Domain of Unknown Function (DUF1053)	Family
  PF00211	Guanylate_cyc	970 → 1164	Adenylate and Guanylate cyclase catalytic domain	Domain

• Sequence:

  MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
  PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
  RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
  VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
  CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
  VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
  KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
  LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
  HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
  YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
  QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
  YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC
  GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLT
  PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
  MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
  ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
  LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
  EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
  FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
  YQLECRGVVKVKGKGEMTTYFLNGGPSS

• Sequence length: 1168