GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

ABCG2 (ATP binding cassette subfamily G member 2 (JR blood group))

Gene

9429

ATP binding cassette subfamily G member 2 (JR blood group)

ABCG2

ABC15, ABCP, BCRP, BCRP1, BMDP, CD338, CDw338, CDw388, EST157481, GOUT1, MRX, MXR, MXR-1, MXR1, UAQTL1

4q22.1

The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2231137	C>T	Association, affects	Coding sequence variant, missense variant
rs2231142	G>C,T	Not-provided, association, drug-response	Coding sequence variant, missense variant
rs200190472	G>A	Affects	Coding sequence variant, stop gained
rs387906869	TG>-	Affects	Coding sequence variant, frameshift variant
rs387906870	AA>-	Affects	Coding sequence variant, frameshift variant

Show/Hide all(136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001952	hsa-miR-520h	Luciferase reporter assay	18189265
MIRT000998	hsa-miR-519c-3p	Western blot, Luciferase reporter assay, qRT-PCR	18573883
MIRT000998	hsa-miR-519c-3p	Luciferase reporter assay	19825807
MIRT001952	hsa-miR-520h	Luciferase reporter assay	19825807
MIRT000081	hsa-miR-328-3p	Review	20026422
MIRT004129	hsa-miR-192-5p	Microarray	16822819
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	19270061
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	19270061
MIRT001952	hsa-miR-520h	qRT-PCR, Western blot	20628378
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000998	hsa-miR-519c-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT000081	hsa-miR-328-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21219875
MIRT001952	hsa-miR-520h	Microarray	18189265
MIRT000081	hsa-miR-328-3p	Reporter assay;Western blot;qRT-PCR;Other	19270061
MIRT029929	hsa-miR-26b-5p	Microarray	19088304
MIRT047731	hsa-miR-10a-5p	CLASH	23622248
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, qRT-PCR, Western blot	22453125
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437399	hsa-miR-181a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23780685
MIRT437871	hsa-miR-142-3p	Luciferase reporter assay, Western blot	23619912
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT438649	hsa-miR-487a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23879965
MIRT526193	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526192	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526191	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT526190	hsa-miR-4539	PAR-CLIP	22012620
MIRT526189	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT526188	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT444289	hsa-miR-369-3p	PAR-CLIP	22100165
MIRT444287	hsa-miR-5692b	PAR-CLIP	22100165
MIRT444288	hsa-miR-5692c	PAR-CLIP	22100165
MIRT444286	hsa-miR-16-2-3p	PAR-CLIP	22100165
MIRT444285	hsa-miR-195-3p	PAR-CLIP	22100165
MIRT444284	hsa-miR-4635	PAR-CLIP	22100165
MIRT444283	hsa-miR-3167	PAR-CLIP	22100165
MIRT444282	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT444281	hsa-miR-889-3p	PAR-CLIP	22100165
MIRT444280	hsa-miR-374a-5p	PAR-CLIP	22100165
MIRT444279	hsa-miR-374b-5p	PAR-CLIP	22100165
MIRT000081	hsa-miR-328-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31701195
MIRT526193	hsa-miR-497-3p	PAR-CLIP	22012620
MIRT526192	hsa-miR-4724-5p	PAR-CLIP	22012620
MIRT526191	hsa-miR-181a-2-3p	PAR-CLIP	22012620
MIRT526190	hsa-miR-4539	PAR-CLIP	22012620
MIRT526189	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT526188	hsa-miR-7158-3p	PAR-CLIP	22012620
MIRT444289	hsa-miR-369-3p	PAR-CLIP	22100165
MIRT444287	hsa-miR-5692b	PAR-CLIP	22100165
MIRT444288	hsa-miR-5692c	PAR-CLIP	22100165
MIRT444286	hsa-miR-16-2-3p	PAR-CLIP	22100165
MIRT444285	hsa-miR-195-3p	PAR-CLIP	22100165
MIRT444284	hsa-miR-4635	PAR-CLIP	22100165
MIRT444283	hsa-miR-3167	PAR-CLIP	22100165
MIRT444282	hsa-miR-876-5p	PAR-CLIP	22100165
MIRT444281	hsa-miR-889-3p	PAR-CLIP	22100165
MIRT444280	hsa-miR-374a-5p	PAR-CLIP	22100165
MIRT444279	hsa-miR-374b-5p	PAR-CLIP	22100165
MIRT759231	hsa-miR-1185	CLIP-seq
MIRT759232	hsa-miR-1206	CLIP-seq
MIRT759233	hsa-miR-1294	CLIP-seq
MIRT759234	hsa-miR-2054	CLIP-seq
MIRT759235	hsa-miR-2117	CLIP-seq
MIRT759236	hsa-miR-3120-3p	CLIP-seq
MIRT759237	hsa-miR-3137	CLIP-seq
MIRT759238	hsa-miR-3144-3p	CLIP-seq
MIRT759239	hsa-miR-3202	CLIP-seq
MIRT759240	hsa-miR-3545-5p	CLIP-seq
MIRT759241	hsa-miR-3605-5p	CLIP-seq
MIRT759242	hsa-miR-3613-3p	CLIP-seq
MIRT759243	hsa-miR-3614-5p	CLIP-seq
MIRT759244	hsa-miR-365	CLIP-seq
MIRT759245	hsa-miR-3679-5p	CLIP-seq
MIRT759246	hsa-miR-3908	CLIP-seq
MIRT759247	hsa-miR-3936	CLIP-seq
MIRT759248	hsa-miR-3942-5p	CLIP-seq
MIRT759249	hsa-miR-4273	CLIP-seq
MIRT759250	hsa-miR-4316	CLIP-seq
MIRT759251	hsa-miR-4433	CLIP-seq
MIRT759252	hsa-miR-4470	CLIP-seq
MIRT759253	hsa-miR-4475	CLIP-seq
MIRT759254	hsa-miR-4477a	CLIP-seq
MIRT759255	hsa-miR-4501	CLIP-seq
MIRT759256	hsa-miR-4659a-5p	CLIP-seq
MIRT759257	hsa-miR-4659b-5p	CLIP-seq
MIRT759258	hsa-miR-4680-3p	CLIP-seq
MIRT759259	hsa-miR-4687-3p	CLIP-seq
MIRT759260	hsa-miR-4703-5p	CLIP-seq
MIRT759261	hsa-miR-4716-5p	CLIP-seq
MIRT759262	hsa-miR-4729	CLIP-seq
MIRT759263	hsa-miR-4747-5p	CLIP-seq
MIRT759264	hsa-miR-4766-3p	CLIP-seq
MIRT759265	hsa-miR-487a	CLIP-seq
MIRT759266	hsa-miR-499-3p	CLIP-seq
MIRT759267	hsa-miR-499a-3p	CLIP-seq
MIRT759268	hsa-miR-548c-3p	CLIP-seq
MIRT759269	hsa-miR-577	CLIP-seq
MIRT759270	hsa-miR-579	CLIP-seq
MIRT759271	hsa-miR-607	CLIP-seq
MIRT759272	hsa-miR-616	CLIP-seq
MIRT759273	hsa-miR-647	CLIP-seq
MIRT759274	hsa-miR-665	CLIP-seq
MIRT1923775	hsa-miR-105	CLIP-seq
MIRT1923776	hsa-miR-1305	CLIP-seq
MIRT1923777	hsa-miR-145	CLIP-seq
MIRT1923778	hsa-miR-3148	CLIP-seq
MIRT1923779	hsa-miR-3180-5p	CLIP-seq
MIRT1923780	hsa-miR-4427	CLIP-seq
MIRT759258	hsa-miR-4680-3p	CLIP-seq
MIRT1923781	hsa-miR-4712-5p	CLIP-seq
MIRT759262	hsa-miR-4729	CLIP-seq
MIRT1923782	hsa-miR-4796-3p	CLIP-seq
MIRT1923783	hsa-miR-548t	CLIP-seq
MIRT1923784	hsa-miR-590-3p	CLIP-seq
MIRT1923785	hsa-miR-770-5p	CLIP-seq
MIRT1923775	hsa-miR-105	CLIP-seq
MIRT759234	hsa-miR-2054	CLIP-seq
MIRT759239	hsa-miR-3202	CLIP-seq
MIRT2165278	hsa-miR-4261	CLIP-seq
MIRT2165279	hsa-miR-4282	CLIP-seq
MIRT759253	hsa-miR-4475	CLIP-seq
MIRT2165280	hsa-miR-4645-3p	CLIP-seq
MIRT2165281	hsa-miR-4652-3p	CLIP-seq
MIRT2165282	hsa-miR-4714-3p	CLIP-seq
MIRT759263	hsa-miR-4747-5p	CLIP-seq
MIRT2165283	hsa-miR-501-3p	CLIP-seq
MIRT2165284	hsa-miR-502-3p	CLIP-seq
MIRT2165285	hsa-miR-891b	CLIP-seq
MIRT2383765	hsa-miR-3927	CLIP-seq
MIRT2383766	hsa-miR-493	CLIP-seq

Transcription factors

Show/Hide all(10)

Transcription factor	Regulation	Reference
AHR	Unknown	20460431
ESR1	Unknown	10342828
MSX2	Unknown	21465479
NFKB1	Activation	10342828
PGR	Unknown	22348324
PPARG	Activation	16785230
RELA	Activation	10342828
SALL4A	Unknown	21526180
SMARCA4	Activation	18234970
SP1	Unknown	21465479

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18056989, 19909340
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	18619525, 23137377
GO:0005886	Component	Plasma membrane	TAS
GO:0006879	Process	Cellular iron ion homeostasis	TAS
GO:0008514	Function	Organic anion transmembrane transporter activity	ISS
GO:0008559	Function	ABC-type xenobiotic transporter activity	IDA	9861027
GO:0015143	Function	Urate transmembrane transporter activity	IMP	19506252
GO:0015225	Function	Biotin transmembrane transporter activity	ISS
GO:0015562	Function	Efflux transmembrane transporter activity	IMP	17145775, 19506252
GO:0015562	Function	Efflux transmembrane transporter activity	ISS
GO:0015711	Process	Organic anion transport	ISS
GO:0015747	Process	Urate transport	IEA
GO:0015878	Process	Biotin transport	ISS
GO:0016021	Component	Integral component of membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0031526	Component	Brush border membrane	IDA	19506252
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032217	Function	Riboflavin transmembrane transporter activity	IDA	17145775
GO:0032218	Process	Riboflavin transport	IDA	17145775
GO:0042626	Function	ATPase-coupled transmembrane transporter activity	IMP	28554189, 30405239
GO:0042802	Function	Identical protein binding	IPI	16870176, 17098188, 19506252, 20399185
GO:0042803	Function	Protein homodimerization activity	IDA	16870176
GO:0042910	Function	Xenobiotic transmembrane transporter activity	ISS
GO:0045121	Component	Membrane raft	IDA	28623970
GO:0046415	Process	Urate metabolic process	IMP	18834626, 19503597, 20053405
GO:0055085	Process	Transmembrane transport	IMP	28554189, 30405239
GO:0070633	Process	Transepithelial transport	IDA	12958161
GO:0097744	Process	Urate salt excretion	IMP	19506252
GO:0098591	Component	External side of apical plasma membrane	ISS	18619525
GO:0140115	Process	Export across plasma membrane	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1990748	Process	Cellular detoxification	IDA	9861027
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IC
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	IDA	12958161

MIM	HGNC	e!Ensembl
603756	74	ENSG00000118777

Protein

UniProt ID

Q9UNQ0

Protein name

Broad substrate specificity ATP-binding cassette transporter ABCG2 (EC 7.6.2.2) (ATP-binding cassette sub-family G member 2) (Breast cancer resistance protein) (CDw338) (Mitoxantrone resistance-associated protein) (Placenta-specific ATP-binding cassette t

Protein function

Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells (PubMed:11306452, PubMed:12958161, PubMed:

PDB

5NJ3 , 5NJG , 6ETI , 6FEQ , 6FFC , 6HBU , 6HCO , 6HIJ , 6HZM , 6VXF , 6VXH , 6VXI , 6VXJ , 7NEQ , 7NEZ , 7NFD , 7OJ8 , 7OJH , 7OJI , 8BHT , 8BI0 , 8P7W , 8P8A , 8P8J , 8PXO , 8PY4 , 8Q7B , 8QCM , 8U2C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00005	ABC_tran	64 → 214	ABC transporter	Domain
PF19055	ABC2_membrane_7	243 → 321	ABC-2 type transporter	Family
PF01061	ABC2_membrane	375 → 586	ABC-2 type transporter	Family

Sequence

MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS

Sequence length

655

Interactions

View interactions

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412