AADAT (aminoadipate aminotransferase)

Gene

• Entrez ID: 51166
• Gene name: Aminoadipate aminotransferase
• Gene symbol: AADAT
• Synonyms: KAT2, KATII, KYAT2
• Chromosome: 4
• Chromosome location: 4q33
• Summary: This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027084	hsa-miR-103a-3p	Sequencing	20371350
MIRT031647	hsa-miR-16-5p	Sequencing	20371350

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006103	Process	2-oxoglutarate metabolic process	IDA	18620547
GO:0006536	Process	Glutamate metabolic process	IDA	18620547
GO:0006554	Process	Lysine catabolic process	TAS
GO:0006569	Process	Tryptophan catabolic process	TAS
GO:0008483	Function	Transaminase activity	IBA	21873635
GO:0009058	Process	Biosynthetic process	IEA
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IBA	21873635
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IDA	18620547
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0033512	Process	L-lysine catabolic process to acetyl-CoA via saccharopine	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	18620547
GO:0047536	Function	2-aminoadipate transaminase activity	IDA	18620547
GO:0070189	Process	Kynurenine metabolic process	IDA	18620547
GO:0097052	Process	L-kynurenine metabolic process	IEA
GO:1901605	Process	Alpha-amino acid metabolic process	IBA	21873635

Other IDs

• MIM: 611754
• HGNC: 17929
• e!Ensembl: ENSG00000109576

Protein

• UniProt ID: Q8N5Z0
• Protein name: Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial (KAT/AadAT) (2-aminoadipate aminotransferase) (2-aminoadipate transaminase) (EC 2.6.1.39) (Alpha-aminoadipate aminotransferase) (AadAT) (Kynurenine aminotransferase II) (Kynurenine--oxoglutarate aminotransferase II) (Kynurenine--oxoglutarate transaminase 2) (EC 2.6.1.7) (Kynurenine--oxoglutarate transaminase II)
• Protein function: Transaminase with broad substrate specificity. Has transaminase activity towards aminoadipate, kynurenine, methionine and glutamate. Shows activity also towards tryptophan, aspartate and hydroxykynurenine. Accepts a variety of oxo-acids as amino-group acceptors, with a preference for 2-oxoglutarate, 2-oxocaproic acid, phenylpyruvate and alpha-oxo-gamma-methiol butyric acid. Can also use glyoxylate as amino-group acceptor (in vitro).
• PDB: 2QLR, 2R2N, 2VGZ, 2XH1, 3DC1, 3UE8, 4GDY, 4GE4, 4GE7, 4GE9, 4GEB, 5EFS, 5EUN, 5TF5, 6D0A, 6T8P, 6T8Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00155	Aminotran_1_2	43 → 417	Aminotransferase class I and II	Domain

• Sequence:

  MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
  IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
  LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
  EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
  FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
  LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
  KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
  IKESL

• Sequence length: 425